SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7JU99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7JU99
Domain Number - Region: 32-111
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0915
Family eIF-2-alpha, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7JU99
Sequence length 160
Comment (tr|K7JU99|K7JU99_NASVI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:NV25745-PA} KW=Complete proteome; Reference proteome OX=7425 OS=Nasonia vitripennis (Parasitic wasp). GN= OC=Chalcidoidea; Pteromalidae; Pteromalinae; Nasonia.
Sequence
MVPKTWLKPKEGIVAWPPGPVTHSKMKNLSPTTNWMEYKYKKIMGPFDFLKGKQLEKEMA
NVSTGKDTEAIIEKSQETNYTGKRQKKPVIFTSEESSDFSDEHDEKKQKKKNKTKMNKKK
KMFHLRRNPSRRLKASQRRMSKLKLIRVYINSFPNLMGLI
Download sequence
Identical sequences K7JU99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]