SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8BI81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K8BI81
Domain Number - Region: 7-80
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.00824
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8BI81
Sequence length 299
Comment (tr|K8BI81|K8BI81_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:CCJ85735.1} KW=Complete proteome OX=1208661 OS=Cronobacter dublinensis 582. GN=BN133_2112 OC=Enterobacteriaceae; Cronobacter.
Sequence
MKTRAGTLNEMARRATHDFDTAVSLIPDSPVNAADKLRAYQTPLASAWLVYLNHFVPASG
VTAQEASKRHQMALDGLRDDDFAYSIMKDIEKDPKESKDKAVLTLLRMNIEKMDYQRDND
DDRPYVHCFIFEAQGQAAYEAFGSLYGSTRDGFAPICKPQDVIFDSPAWTALNEAFSEPL
EKASDGAGTIKYSSYADWEIFELHVTVKPEDYLNAAAPDKKQQDPEQEIRAWKDDAAWPK
AQREKALAALEPARKATQAWLQNDRGWTAENARKGADNIVRQWLDDRVTFIDGSGWTGE
Download sequence
Identical sequences K8BI81
WP_007751506.1.56843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]