SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8FER5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8FER5
Domain Number 1 Region: 41-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-83
Family Protein kinases, catalytic subunit 0.00000121
Further Details:      
 
Domain Number 2 Region: 335-482
Classification Level Classification E-value
Superfamily EF-hand 2e-42
Family Calmodulin-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8FER5
Sequence length 501
Comment (tr|K8FER5|K8FER5_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO66491.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy09g03620 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MGCAASTAKGEKSVKIHSNGPLGAKSKKGSVLGRTTSDINDIFTFHEELGKGQFGTTYKI
KNKKTGEEYACKAIAKRKLTSKEDIDDVRREISILHHLGGHDNIVCCEGAYEGARHVYIV
MELLQGGELFDRIVERGKYSEKDAADCFRTIVETIQHCHELGVVHRDLKPENFVLKSKDY
DSKICAIDFGLSAFFHEDQVFHEIVGSAYYVAPEVLRRSYGKAADVWSCGVILYILLSGV
PPFWATTENGIFDMVLKGQYDLEQDPWGAISAGAKDLIAKMLVQDPKKRISPEDALNHPW
LTGGAPAKKLDNAIVKRLKSFAAITKFKKLGLIAMAKTLSPDELEGLREMFKSFDTDNSG
TISIAELQAGLRKKGSSQATEELQQLMNEIDIDGNGELDYEEFVAATLSMASQHSGDAME
KTFAYFDVDGDGSITIEEFKMALDKMPAGARANFGDVNELVAMADQDGDGLIDYEEFVAM
MQAGDKPDKNAMKNAKMAGYA
Download sequence
Identical sequences K8FER5
Bathy09g03620 XP_007510931.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]