SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9MR69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9MR69
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Agglutinin 6.67e-23
Family Agglutinin 0.00031
Further Details:      
 
Domain Number 2 Region: 188-336
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 7.59e-17
Family ETX/MTX2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9MR69
Sequence length 347
Comment (tr|K9MR69|K9MR69_9ASTR) Hfr-2-like protein {ECO:0000313|EMBL:AFX65833.1} OX=1243768 OS=Senecio aethnensis x Senecio chrysanthemifolius. GN= OC=Asteroideae; Senecioneae; Senecioninae; Senecio.
Sequence
ISMALLPSFFVLQSGGKYLSVTDNISSNLPSGFVKFGDEPIWSPRVKFAVEQTNTDEDRF
VHIRSCYNNKYLVMNQIDSNSWIVASAKKLEEDDSKDSCTLFEPYSLEDDETTNVRLRPV
QLTEIYSSISHDSDTHQGMRVSPVGSTFKAINWESVVILPSQVAFRSEDLNGNYLRSIVL
YEGLVYQKFVSGLDIGDPLECVIKRKLLDLDYRLNDSRIYNERIIEVDHSYGDNDTSEAN
TMNLRFSQNNTKTRSWTNSISVKFGVTASLEVNLVPAIVSGAIELSAEYGSTHEWGEEES
TETIREANYTITIPPFFKMKVSMMCKRGHCDVPFSYTQRDLQTSGSW
Download sequence
Identical sequences K9MR69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]