SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9XM67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9XM67
Domain Number 1 Region: 3-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-97
Family Cystathionine synthase-like 0.000000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9XM67
Sequence length 389
Comment (tr|K9XM67|K9XM67_9CHRO) Cysteine desulfurase {ECO:0000313|EMBL:AFZ32792.1} KW=Complete proteome; Reference proteome OX=1173026 OS=Gloeocapsa sp. PCC 7428. GN=Glo7428_4349 OC=Chroococcaceae; Gloeocapsa.
Sequence
MQIYLDYSATTPPRPEAIAAMQAVLTQYWGNPSSLHEWGGRAATVLEQARMQVASLINAP
AESIVFTSGGTEADNLAIMGIARQYSQPQHIIISQVEHPAIAEPVKLLEQWGWQVTRLPV
DTQGRVNPLELKAALRSNTVLVSIIYGQSEVGTLQPIESLCRITHLHGALFHTDAVQVAG
RLPIDVQQLPIDLLSLSSHKIYGSQGTGALYVRPGIEIVPLLGGGGQESRRRSGTEAVPI
IAGFGVAAELAAQEMTLETPRLIQLRDRLFDLLSDTPYLIPTGDRTARLPHHVSFCLAYT
DENNITGKTIVRQLNLAGIAISSGSACQSGKLSPSPILCAMGYTPQQALGAIRLTLGRDT
TTADVDWTAIVLKQVLHRSIPKLTCASCS
Download sequence
Identical sequences K9XM67
WP_015190659.1.9315 gi|434395005|ref|YP_007129952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]