SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9YVR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9YVR9
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily XisI-like 5.49e-43
Family XisI-like 0.00000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9YVR9
Sequence length 111
Comment (tr|K9YVR9|K9YVR9_DACSA) XisI protein {ECO:0000313|EMBL:AFZ50994.1} KW=Complete proteome OX=13035 OS=Dactylococcopsis salina PCC 8305. GN=Dacsa_2387 OC=Dactylococcopsis.
Sequence
MDKLTQYRKLIKKLLSRYASYKKDQEGWELQLIFDEERDHYLWFDVGWNGTKRIYHCVIH
LDIKDGKVWLQQNSTDLNPAEDLIELGVAREDIILGLQPPYKRPFTNYGVA
Download sequence
Identical sequences K9YVR9
gi|428780565|ref|YP_007172351.1| WP_015229985.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]