SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0GC32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0GC32
Domain Number 1 Region: 101-171
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 2.22e-19
Family T-antigen specific domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000000942
Family Chaperone J-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0GC32
Sequence length 190
Comment (tr|L0GC32|L0GC32_9POLY) Small T antigen {ECO:0000313|EMBL:AGA82581.1} KW=Complete proteome; Reference proteome OX=2035998 OS=Otomops polyomavirus KY156. GN= OC=Viruses; dsDNA viruses, no RNA stage; Polyomaviridae.
Sequence
MDRLFEKSEKDKLLQMLGVGSNCFCNFPLMKQAYKKASKKFHPDKGGNNEQMMLLNSLWQ
KYQEGIIDMRNSEVCDISIGELLTITLQEHFGSKLREMMLKTPLCIVKGYTSCKCICSLL
INQHSQLKEILDKKCLTWGECFCYFCFQLWYGLPHNWDTFELWSAVLAEYPTGLLQLDLS
KYGFKIILLF
Download sequence
Identical sequences L0GC32
YP_007346960.1.43454 gi|440285300|ref|YP_007346960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]