SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0KU53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0KU53
Domain Number 1 Region: 29-186
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 2.62e-40
Family AF0587 domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L0KU53
Sequence length 227
Comment (tr|L0KU53|L0KU53_METHD) Uncharacterized protein {ECO:0000313|EMBL:AGB48952.1} KW=Complete proteome; Reference proteome OX=867904 OS=DMS1). GN=Metho_0700 OC=Methanosarcinaceae; Methanomethylovorans.
Sequence
MKQIIIPENERSTEPLDTEMVIYHPDMKRANEWILTEYQPPVRDFCIFVPCSKKKPYHES
PSHKIFDRLIFGILEPEMVHIVVFGTCGITPRELDEQYPFMDYQFMMGKCNVSKIKRDFI
RMESERLARYLERTKSNYKHRIAYCIGDFRTAMEKAVETTSVPVTIVPKRETIEKNIQPS
KGFIYGSLNQRDYLQDLAEAISKPLGRSVIEVNEKEQMINDNDWYVL
Download sequence
Identical sequences L0KU53
gi|435850896|ref|YP_007312482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]