SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L1IT01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L1IT01
Domain Number 1 Region: 88-232
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.15e-20
Family Eukaryotic type heme oxygenase 0.013
Further Details:      
 
Weak hits

Sequence:  L1IT01
Domain Number - Region: 297-305
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0103
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L1IT01
Sequence length 328
Comment (tr|L1IT01|L1IT01_GUITH) Uncharacterized protein {ECO:0000313|EMBL:EKX39348.1, ECO:0000313|EnsemblProtists:EKX39348} KW=Complete proteome; Reference proteome OX=905079 OS=Guillardia theta CCMP2712. GN=GUITHDRAFT_89115 OC=Eukaryota; Cryptophyta; Pyrenomonadales; Geminigeraceae; Guillardia.
Sequence
MRSLIPALLCSLCSITATTAFMQPSLRTSLLLRNAAPMMCAKSTPSAEVASVPFTQEMRQ
KAMSLHTFSQAPREGKQKDASANTVVDQWETTKEDYLQFLVDSKVVYEAFEKEVQRSGLE
KFRNTGLERVRGLEKDIEWIEKSFNIKPLKATDQSKEYAQYLSTLSIPVFLTHFYNYYFA
HTAGGRMIGKQVMDSVFDGHLFEFYKWDGDVKEILTKVKGFIDETAEGWTREMVILFLPL
PFSRSLICSFLFYSILLLSSPPLFFSLFLLPPISSLLPLLYSSLLLIISCASRLLPPPPP
PPPPPPPLMIIMLLRGTPQTHSYASCLS
Download sequence
Identical sequences L1IT01
XP_005826328.1.50599 jgi|Guith1|89115|estExt_Genewise1Plus.C_760030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]