SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L1LTZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L1LTZ9
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.41e-37
Family STM4215-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L1LTZ9
Sequence length 161
Comment (tr|L1LTZ9|L1LTZ9_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:EKX82478.1} KW=Complete proteome; Reference proteome OX=1005395 OS=Pseudomonas putida CSV86. GN=CSV86_24759 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MMPKTQTTVLQDALLTRLQEHFARELSVELFPEAPGQYRLNHSRGAILVAYGRSKFNNSE
ATDAAFQERQLVFRLTLVFRQLNGKDGVTSYLDRIRKVLTGWYPPHCDRACQPLMEQFLG
HTQGVWQYALDITTGATQIQVVAPRSDPLLTRADFEHEGFQ
Download sequence
Identical sequences L1LTZ9
WP_009405535.1.54879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]