SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L2THR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L2THR5
Domain Number - Region: 47-72
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0759
Family Proteinase A inhibitor IA3 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L2THR5
Sequence length 101
Comment (tr|L2THR5|L2THR5_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:ELB90650.1} KW=Complete proteome OX=1195242 OS=Rhodococcus wratislaviensis IFP 2016. GN=Rwratislav_23279 OC=Rhodococcus.
Sequence
MAPPRKGSRDGIVSRVVFFVVVIGIVFGVFQYVTGGVKVGDDGWVRTGQQKISELFDRGS
EVTKGELEDITDGAGTQIGEQIREQLSTTPTQAPAPEGEGE
Download sequence
Identical sequences L2THR5
WP_005567735.1.11008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]