SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5LHX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5LHX2
Domain Number 1 Region: 67-196
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-44
Family Regulator of G-protein signaling, RGS 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L5LHX2
Sequence length 207
Comment (tr|L5LHX2|L5LHX2_MYODS) Regulator of G-protein signaling 19 {ECO:0000313|EMBL:ELK25812.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10009513 OC=Vespertilionidae; Myotis.
Sequence
QHTGPEEADQPPSMSSHAGPPAPPSRNPCCLCWCCCCSCSWSEGRRPAWRASGESKLQPL
PSCEACSTPSPEEVQSWAQSFDKLMHSPAGRSAFRAFLRTEYSEENMLFWLACEELKAEA
NQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHR
DSYPRFLSSPAYRALLLQGDSQSSHEA
Download sequence
Identical sequences L5LHX2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]