SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L5P0Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5P0Q9
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily MTH889-like 9.29e-31
Family MTH889-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L5P0Q9
Sequence length 99
Comment (tr|L5P0Q9|L5P0Q9_9EURY) Uncharacterized protein {ECO:0000313|EMBL:ELK55953.1} KW=Complete proteome OX=1243180 OS=Haloferax sp. BAB2207. GN=D320_01888 OC=Haloferax.
Sequence
MAPIRRLVLDVLKPHSPSTVEVAREVADAAGVAGVNATLLETDREVQNLRLVVEGEAIDA
DEVERRVRDLGGTVHSVDEVVAGETLVEYRNQPQDPSPP
Download sequence
Identical sequences L5P0Q9
WP_008605461.1.102041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]