SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7FI42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7FI42
Domain Number - Region: 25-48
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.0353
Family Nucleolar RNA-binding protein Nop10-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7FI42
Sequence length 137
Comment (tr|L7FI42|L7FI42_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:ELP70849.1} KW=Complete proteome; Reference proteome OX=698760 OS=Streptomyces turgidiscabies Car8. GN=STRTUCAR8_05040 OC=Streptomyces.
Sequence
MEARGGLMSAAYGKCFDPTGARYGVPTFPWKFAPDDEQFATRRQLRARGLRPGGQPIAAQ
VMRVNRRSGGVRVAYLYRLDLAKPVRPMTSRKWGALALAMLARRTCPNCRVIYSYCMPTS
LGMCVLCAFPEPTPMEG
Download sequence
Identical sequences L7FI42
WP_006373852.1.33242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]