SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7N231 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7N231
Domain Number 1 Region: 61-92
Classification Level Classification E-value
Superfamily Defensin-like 0.000000000323
Family Defensin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7N231
Sequence length 93
Comment (tr|L7N231|L7N231_MOUSE) Predicted gene 15292 {ECO:0000313|Ensembl:ENSMUSP00000096494} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm15292 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MKTLVLLSALFLLAFQVQADPIQKTDEETNTEVQPEEEEQAMSVSFGNPEGSDLQEESLR
DLGCYCRKRGCTRRERINGTCRKGHLMYTLCCL
Download sequence
Identical sequences L7N231
ENSMUSP00000096494 NP_001170958.1.92730 10090.ENSMUSP00000096494 ENSMUSP00000096494 ENSMUSP00000096494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]