SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7UJL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7UJL7
Domain Number - Region: 37-135
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0388
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L7UJL7
Sequence length 148
Comment (tr|L7UJL7|L7UJL7_MYXSD) Uncharacterized protein {ECO:0000313|EMBL:AGC47722.1} KW=Complete proteome; Reference proteome OX=1278073 OS=Myxococcus stipitatus (strain DSM 14675 / JCM 12634 / Mx s8). GN=MYSTI_06449 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MKKKLAIAGSAVVAVVLLSGFAFRGGHGPCPNPERIKQVVTWKLDDKLEDLDATDAQRES
IHAVKDRLFTEGVQLAQEQHATRSEVVTQLESDTPDAQALHALVDARIEALRAFAHKATD
AVLEVHGTLTPEQRKTLASEYKERMGLE
Download sequence
Identical sequences L7UJL7
WP_015351976.1.99865 gi|442323385|ref|YP_007363406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]