SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8GDR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8GDR4
Domain Number 1 Region: 15-106
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.96e-31
Family eIF-2-alpha, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8GDR4
Sequence length 107
Comment (tr|L8GDR4|L8GDR4_ACACA) Eukaryotic initiation factor, putative {ECO:0000313|EMBL:ELR11162.1} KW=Complete proteome; Reference proteome OX=1257118 OS=Acanthamoeba castellanii str. Neff. GN=ACA1_388420 OC=Acanthamoebidae; Acanthamoeba.
Sequence
KDNILKTIQHRLGSQPVKIQADIQVTCFSYEGIDAIKPALRAGQQCSTPDSPVRIQLVTS
PEYILLTSSTDHERGVALLKKAVEAIQTEIKKHGGDCVIKTEPRVVA
Download sequence
Identical sequences L8GDR4
XP_004333175.1.79595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]