SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8HN58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8HN58
Domain Number 1 Region: 44-183
Classification Level Classification E-value
Superfamily Stathmin 7.45e-47
Family Stathmin 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8HN58
Sequence length 188
Comment (tr|L8HN58|L8HN58_9CETA) Stathmin {ECO:0000256|RuleBase:RU004388} OX=72004 OS=Bos mutus (wild yak). GN=M91_04660 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPTAYKEKMKELSVLSLICSCFYSQPHPNTVYQYGAPTCSCPADMEVKQLDKRASGQSFE
VILKSPSDLSPESPVLSSPPKRKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHER
EVLHKALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRPCPLRLSWQELHAAEVRRNK
EQREEMSG
Download sequence
Identical sequences L8HN58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]