SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8J4E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L8J4E6
Domain Number - Region: 116-154
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0366
Family N-terminal coiled coil domain from apc 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8J4E6
Sequence length 159
Comment (tr|L8J4E6|L8J4E6_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ELR63725.1} KW=Complete proteome; Reference proteome OX=1056511 OS=Photobacterium marinum. GN=C942_03394 OC=Vibrionaceae; Photobacterium.
Sequence
MANGQELAKENVDKFNDWLKSMTDDDFRVMEHRGSLKRKLVAKGCGFAVSVLRQNPKVRA
LFVDLEDDLRKRSILPPLKEKESPNKDESQELDQDEAKRGTQAAHANRLEQDNIELKAKV
AKLTAEKEKLEQELEKTGRKLNRLDAFNTALAEVGRLPR
Download sequence
Identical sequences L8J4E6
WP_007470075.1.39489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]