SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8JZ71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L8JZ71
Domain Number - Region: 33-53
Classification Level Classification E-value
Superfamily Hypothetical protein Ta0289 C-terminal domain 0.0301
Family Hypothetical protein Ta0289 C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8JZ71
Sequence length 62
Comment (tr|L8JZ71|L8JZ71_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ELR72949.1} KW=Complete proteome; Reference proteome OX=1237149 OS=Fulvivirga imtechensis AK7. GN=C900_00910 OC=Fulvivirga.
Sequence
MKTIKDFQHNELDRQTVEKVMGGEPVSDGYEEVYYDQGGVTHVYHCRNGNCVYIRSMEGM
IA
Download sequence
Identical sequences L8JZ71
WP_009578612.1.12048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]