SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8PVP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8PVP0
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily YugE-like 4.45e-29
Family YugE-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8PVP0
Sequence length 86
Comment (tr|L8PVP0|L8PVP0_BACIU) Uncharacterized protein {ECO:0000313|EMBL:ELS60093.1} KW=Complete proteome OX=1236548 OS=Bacillus subtilis subsp. inaquosorum KCTC 13429. GN=BSI_36090 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEESQAVREMIKIIAKWDPFKYGEEFYETEAVDVVQAVYDEDDPDVLAKSIQHIFEVSFE
QTLPIDSCREVAGQLLFIKDSSSCTP
Download sequence
Identical sequences L8PVP0
WP_003241090.1.46869 WP_003241090.1.59841 WP_003241090.1.93400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]