SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L9KH60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L9KH60
Domain Number - Region: 188-253
Classification Level Classification E-value
Superfamily Stathmin 0.0706
Family Stathmin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L9KH60
Sequence length 282
Comment (tr|L9KH60|L9KH60_TUPCH) Uncharacterized protein {ECO:0000313|EMBL:ELW62041.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100005475 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MATRVLCKVFLSIKGMHYQVEVRGHPPCGSHPTPSPMTMDRHGLPGHGHCHRAPHHPAGL
RPLPPLPVVEPALPSKLEGQPQAEVPARGPSCWIPRALEKAAALAASLARGGAAMEQKVE
EADFLAMRRWRCRRRVTYNVADSCFTPGGPLARAADPVIGGCFVQPSSSCPLQSTSPGSS
CLPPLALRAGEGRYVPAEKLELLALQEERTQEILKKHLTRDQDWERRKIRQASTLEEKRR
AQEEAVRADKAQKARLVRVLVTPLRAKGSFEPPDLTKAGPRT
Download sequence
Identical sequences L9KH60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]