SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L9UTG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9UTG4
Domain Number 1 Region: 218-293
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000000785
Family Cna protein B-type domain 0.0041
Further Details:      
 
Domain Number 2 Region: 126-197
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000247
Family Carboxypeptidase regulatory domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L9UTG4
Sequence length 299
Comment (tr|L9UTG4|L9UTG4_NATMM) Cna B domain-containing protein {ECO:0000313|EMBL:ELY28230.1} KW=Complete proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=C500_13771 OC=Natrialba.
Sequence
MLTVAGVVLLVAGLALAASGASINGALGPFGDDSDETEPDVDEPDADGGDDDSTAGDDGG
DTDETDETDDTDDADDGSESDESNDGAGDDDDGADDDDGADDEDDAGNGDENGGDDADDE
HTLTATIEDDDGDEIENATVELTSGLSSSERTADDDGTVEFTVDDGEYTLTASADGYEEA
EADVEIDGDDEDVTLELESDEDEDEDEDDTDADDEYTLTTLVEDDDDGDEIEDATIELYT
GNQLFGPDAEATTDDDGEAELEVEEGEYTVIVTADDYEEAEFNLEVDDDDEITVVLEED
Download sequence
Identical sequences L9UTG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]