SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0A4Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0A4Y4
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 1.23e-35
Family Dom34/Pelota N-terminal domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 244-354
Classification Level Classification E-value
Superfamily L30e-like 8.24e-25
Family ERF1/Dom34 C-terminal domain-like 0.003
Further Details:      
 
Domain Number 3 Region: 132-247
Classification Level Classification E-value
Superfamily Translational machinery components 2.94e-24
Family ERF1/Dom34 middle domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0A4Y4
Sequence length 355
Comment (tr|M0A4Y4|M0A4Y4_9EURY) Protein pelota homolog {ECO:0000256|HAMAP-Rule:MF_01853, ECO:0000256|SAAS:SAAS01014537} KW=Complete proteome OX=1227493 OS=Natrialba hulunbeirensis JCM 10989. GN=C483_05503 OC=Natrialba.
Sequence
MQIKDREPLDGGRERVTVVPESVDDLWHLQYVLEPGDRVAGDTTRRIQRNDDQMRDTGGE
REHMWVAIAVEDIEFHKFANRLRVGGEIVACSREDQLGFHHTLNVEEREELSIEKRFKPD
QEARLEEAEEATENPDVAIATVEEGQAHVHTVAQYGTEERATITGPTGKGEYARERSELF
AELGDVLKRQDADAIILAGPGFTKQDARKYLEDNEPAVAEKLTMVDTASVGDRGVHEVLK
RGAVADVQQETRIESEAEYIDQLTERIAQGAKAAYGPEAVQQAAEFGAIERLLILDDRLR
KERGPDGEWAIDVDQVVRTAEQKGGEVTVFSSEFPPGQQLSNLGGIAALLRYRLE
Download sequence
Identical sequences M0A4Y4
WP_006652343.1.21476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]