SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0BRQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0BRQ2
Domain Number 1 Region: 10-57
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.000000000000379
Family Nucleolar RNA-binding protein Nop10-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0BRQ2
Sequence length 59
Comment (tr|M0BRQ2|M0BRQ2_9EURY) Ribosome biogenesis protein Nop10 {ECO:0000256|HAMAP-Rule:MF_00803} KW=Complete proteome OX=1227489 OS=Haloterrigena thermotolerans DSM 11522. GN=C478_09284 OC=Haloterrigena.
Sequence
MKSDIRVCSAWQDVHDRPVYTLSATCPECGADAENSAPAPLDPADPHGEYRRSLKRRNR
Download sequence
Identical sequences M0BRQ2
WP_006649430.1.34543 WP_006649430.1.47720 WP_006649430.1.97852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]