SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0GQ55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0GQ55
Domain Number 1 Region: 10-57
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 0.00000000000000811
Family Nucleolar RNA-binding protein Nop10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0GQ55
Sequence length 79
Comment (tr|M0GQ55|M0GQ55_9EURY) Ribosome biogenesis protein Nop10 {ECO:0000256|HAMAP-Rule:MF_00803} KW=Complete proteome; Reference proteome OX=1227460 OS=Haloferax larsenii JCM 13917. GN=C455_17539 OC=Haloferax.
Sequence
MKSDIRVCSAWRGRHDRPVYSLSQTCPECGASTENSAPAPYNPDDTYGEYRRARKRRAAE
GSQTDEESQATRDSQATEE
Download sequence
Identical sequences M0GQ55
WP_007545078.1.76191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]