SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0HYJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M0HYJ2
Domain Number - Region: 17-88
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 0.0301
Family MAST3 pre-PK domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0HYJ2
Sequence length 105
Comment (tr|M0HYJ2|M0HYJ2_9EURY) Uncharacterized protein {ECO:0000313|EMBL:ELZ88803.1} KW=Complete proteome OX=1230453 OS=Haloferax elongans ATCC BAA-1513. GN=C453_01030 OC=Haloferax.
Sequence
MTQSDPTFHPVTDEEFEQMDEKLAEFFDKVRAAMDAAIQADLEEMECPEMLKDKKSDPTF
RPVTEEEFEQMDEKIAVFFDEARAKMDAAVQADLDAMEDESKDLE
Download sequence
Identical sequences M0HYJ2
WP_008322112.1.46416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]