SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0RBE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0RBE8
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000048
Further Details:      
 
Domain Number 2 Region: 242-370
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.31e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000209
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0RBE8
Sequence length 503
Comment (tr|M0RBE8|M0RBE8_RAT) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSRNOP00000066881} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Was OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSSGPVGGRSGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPLTPAPTNEERRGGLPPVPPH
PGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPPPPPPCRGGGGSQPLRPPVGSNNGRCGPLPPVPMGGAPPPPTPRVPPP
PGRGGPPPPPPPATGRFGPPPPPLPGAGGPLAPPPXPXPPPPPPVCPGSGPAPPPLPPTP
VSGVGPAPGGGRGALLDQIRQGIQLNKTPGAMENSVPQALPQQSEGLVGALMHVMQKRSK
VIHSSDEGEDQTGEDEEDDEWDD
Download sequence
Identical sequences M0RBE8
ENSRNOP00000066881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]