SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0XKJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0XKJ0
Domain Number 1 Region: 97-161
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-19
Family Homeodomain 0.004
Further Details:      
 
Weak hits

Sequence:  M0XKJ0
Domain Number - Region: 195-205
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0366
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0XKJ0
Sequence length 277
Comment (tr|M0XKJ0|M0XKJ0_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU4Hr1G065900.1} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MAQEEVHDAGLALGLSLGGGSSSAHRSNNSSRLTLWEAPSAEPSLTLSMPDDPTMTGRTA
SGGVSSMSVGGAVKRERAEEAELGEMVSSTAVVAAEEDDDGSTRKKLRLTKEQSALLEDR
FKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEEN
RRLQRELQELRAIKFAPPPPPPPPPNNAGQHPGTPSAAAAPAPAPPFYMQLPAATLTICP
SCERLSGTAATAAGKVDPDRPKATHHFFNPFTHSAAC
Download sequence
Identical sequences M0XKJ0
MLOC_60848.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]