SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1EKH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1EKH9
Domain Number 1 Region: 46-83
Classification Level Classification E-value
Superfamily Defensin-like 0.00000000142
Family Defensin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1EKH9
Sequence length 84
Comment (tr|M1EKH9|M1EKH9_MUSPF) Defensin, beta 1 {ECO:0000313|EMBL:AER97104.1} OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
EPLCLPRASRPGLPAAMRALSFLLLILCLVSSHLAPGAGFLSGLGQRSDHYMCARKGGTC
NFSPCPLFTRLEGTCYGGKAKCCM
Download sequence
Identical sequences M1EKH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]