SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1HD01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1HD01
Domain Number - Region: 12-89
Classification Level Classification E-value
Superfamily TM1646-like 0.0301
Family TM1646-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M1HD01
Sequence length 135
Comment (tr|M1HD01|M1HD01_9PHYC) Uncharacterized protein {ECO:0000313|EMBL:AGE49642.1} OX=1278269 OS=Acanthocystis turfacea Chlorella virus Can0610SP. GN=ATCVCan0610SP_915L OC=unclassified Chlorovirus.
Sequence
MDFLKNVERYVELHQNLIDVAKTTKDMRKEKTILGKELLEYMVSHNIKEHSYEDFDIINN
EKEVKNKMSIEVIEGMLEQFNNEVLDQQKIDSIISAIANSELSGDTKNSLSIKKKKGEKK
PRKSKKQAEAENYED
Download sequence
Identical sequences A7KA29 M1HD01 M1HLE3 M1HW36 M1I3V1 M1IAN5 M1IF21
gi|155371716|ref|YP_001427250.1| YP_001427250.1.25622 A7KA29_9PHYC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]