SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1HPR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1HPR0
Domain Number - Region: 128-209
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.051
Family Gametocyte protein Pfg27 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1HPR0
Sequence length 213
Comment (tr|M1HPR0|M1HPR0_9PHYC) Uncharacterized protein {ECO:0000313|EMBL:AGE51631.1} OX=1278253 OS=Paramecium bursaria Chlorella virus CviKI. GN=PBCVCviKI_609L OC=unclassified Chlorovirus.
Sequence
MKKRYIFGLVLLALFALAGMGSVIYMNWSDIKDMFSETIGKNKKSSLKQVDVLVVKPDQS
NVVQKDVKEILNVPKDDPKLKKDLSAIQQKKTSTDAKITTLTKTAVDTIKKESEVVKTKA
PKLAAVVVDNVKKIELNAQKNASSKYAELIKQIEQEKMKASIFLTGNISEKEKIAKINNI
DAEIEIVDNFKVDSVKKVWTKKMADYMVMKGRL
Download sequence
Identical sequences M1HLB1 M1HPR0 M1HYZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]