SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1NS07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1NS07
Domain Number - Region: 27-76
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.000327
Family N-terminal coiled coil domain from apc 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1NS07
Sequence length 155
Comment (tr|M1NS07|M1NS07_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AGF87494.1} KW=Complete proteome; Reference proteome OX=1289598 OS=Streptococcus phage phi7917. GN=phi7917_0019 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Podoviridae.
Sequence
MSFKPIETQEELDRIIGERLGRQKEKYADYDQLKNRVSELEKENGVLKSAAESTKASTSD
LEKQIAELQGQVKTYEGKDLRLRVAVANGLPIELADRLAGDDEEAIKADAERLASFMKPT
EPTPPMASTEPNVPKDVNNNRELFRGMVQNLGLED
Download sequence
Identical sequences M1NS07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]