SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1PM53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1PM53
Domain Number 1 Region: 124-411
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.26e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000185
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.1e-67
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1PM53
Sequence length 412
Comment (tr|M1PM53|M1PM53_9ARCH) Methyl coenzyme M reductase alpha subunit {ECO:0000313|EMBL:AGF92165.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
QEHMVETHPGLVDDCYVKVFTGDDEMADSLEKQFVIPIDKLFPKKSAEALKAAVGKSMWQ
AVHIPTIVSRTCDGGTTSRWSAMQLGMSFIGAYRMCAGEAAVADLAYAAKHAGVIQMADI
LPARRARGPNEPGGIKFGHFADMIQGDRKYPNDPAKATLEVVGAGAMLFDQIWLGSYMSG
GVGFTQYATAAYTDNILDDYTYYGMDYIKDKYKIDITNPNEKDKVKPTQDIVNDIAGEVT
LYGMEQYEQFPTALETHFGGSQRASVLAAAAGISSAIATGNSNAGLNGWYLSMLMHKEGW
SRLGFFGYDLQDQCGSTNSLSMRPDEGAIGELRGPNYPNYAMNVGHQGEYAAIAGAAHYS
RGDAWSLSPLIKITFADPSLKFDFAEPRREFAKGALRQYMPAGERSLIIPAR
Download sequence
Identical sequences M1PM53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]