SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2B6K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M2B6K3
Domain Number - Region: 3-47
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0157
Family PA2201 N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M2B6K3
Sequence length 66
Comment (tr|M2B6K3|M2B6K3_9PLAN) Transposase {ECO:0000313|EMBL:EMB17373.1} KW=Complete proteome OX=1263867 OS=Rhodopirellula europaea 6C. GN=RE6C_01911 OC=Planctomycetaceae; Rhodopirellula.
Sequence
MQIDWADSKYDNHALIAWLGPQRIIASYSAPKAAKGFVLLPKRWGVQRTFSRFGRWWRLL
KANGIG
Download sequence
Identical sequences M2B6K3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]