SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2BH34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2BH34
Domain Number 1 Region: 101-150,199-276
Classification Level Classification E-value
Superfamily TPR-like 7.59e-19
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  M2BH34
Domain Number - Region: 25-105
Classification Level Classification E-value
Superfamily ImpE-like 0.0667
Family ImpE-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2BH34
Sequence length 303
Comment (tr|M2BH34|M2BH34_TREDN) Uncharacterized protein {ECO:0000313|EMBL:EMB28730.1} KW=Complete proteome OX=999431 OS=Treponema denticola H1-T. GN=HMPREF9725_02342 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MKKRIIFFLILLVSFRIFADYKSEYDNLLSARNIKGIAALLPKWEKAEPKNPELYIAYFN
YYLLKGQRSTQSLDTYKKDNTNSLALADQKTNKIAGYLNNNIWYEKEDVDKALSYLEKGL
KFGKNRLDMYFGRIHILGEIGEYEKQSQKIIEVLKLGKEINHKWLWSMNEVIPSSESEHF
FLISINEYYKNWLQKSSPQTLNAAEKTGEAQLKLYPKNIEVHNYLSLAYIGQGKFKEALN
VLLKADKLANEDYVIIFNMGRCYEALKQYDKAKECYLRMKKNPNKQVQDMADQKLSELKK
LTK
Download sequence
Identical sequences M2BH34
WP_002689594.1.76680 WP_002689594.1.76838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]