SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3DA46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3DA46
Domain Number 1 Region: 222-242
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0000745
Family Hydrophobin II, HfbII 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3DA46
Sequence length 283
Comment (tr|M3DA46|M3DA46_SPHMS) Uncharacterized protein {ECO:0000313|EMBL:EMF14754.1} KW=Complete proteome; Reference proteome OX=692275 OS=(Septoria musiva). GN=SEPMUDRAFT_107033 OC=Sphaerulina.
Sequence
MQYSIIFLAALAAANPMANSGNKQQGYGSNAPSYGDEQQSPPGYNAGPSTTTSSWSKSSF
VKPTTTSTWVHTSTVTSSTHVTPTTKGAKPKSSSSSSSSSSSSSSSSSYSSSSSTGPAKY
HTTLETSSKSSIHPTSSKGPKSQSSSSTSTSSTGPTKYHTTLSTSSKSSAQPTPTKGMSG
STGSTSSSTKNNGKSGSNNGSSGKSNSNTNTNGSQVCPSTAFPQCCQLNVLGLAGVSCSN
GKTSLFLFFPSSSSHRSLPIIITTNHHPPSSSSSILICDKKNL
Download sequence
Identical sequences M3DA46
XP_016762875.1.6424 jgi|Sepmu1|107033|fgenesh1_pg.3_#_692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]