SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XV94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XV94
Domain Number 1 Region: 89-343
Classification Level Classification E-value
Superfamily SET domain 6.76e-63
Family RuBisCo LSMT catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 347-516
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 1.57e-45
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XV94
Sequence length 599
Comment (tr|M3XV94|M3XV94_MUSPF) Histone-lysine N-methyltransferase {ECO:0000256|PROSITE-ProRule:PRU00898} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SETD3 OC=Mustelinae; Mustela.
Sequence
MTEFSKTSQKMGKKSRVKTQKSGTGATASVSPKETLNLTSELLQKCSSPAPGPGKEWEEY
VQIRSLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRA
TRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNITLAFHLLCERADPNS
FWQPYIQTLPSEYDTPLYFEEDEVRDLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHA
NKLPLKDAFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNL
EDDRCECVALRDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLY
AMKAEVLARAGIPTSSVFALHSTEPPVSAQLLAFLRVFCMTEEELKEHLLGDNALDRIFT
LGNSEYPVSWDNEVRLWTFLEDRASLLLKTYKTTIEEDKSFLKDHDLSVRAAMAIKLRLG
EKEILEKAVKSAAANREHYRKQMQAGAALPRCEESGAAGARLPLALRNLEEEAGAQEALT
LTEAVSRAKAVENGLVNGENSIPNGTGSEKGSLSPEESKRATESTKECSSDSTEGGSAQ
Download sequence
Identical sequences M3XV94
XP_004754773.1.14098 ENSMPUP00000002994 ENSMPUP00000002994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]