SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y8D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y8D9
Domain Number 1 Region: 184-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000122
Family PHD domain 0.021
Further Details:      
 
Domain Number 2 Region: 40-90
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000158
Family Tudor domain 0.0074
Further Details:      
 
Domain Number 3 Region: 92-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000012
Family PHD domain 0.0092
Further Details:      
 
Weak hits

Sequence:  M3Y8D9
Domain Number - Region: 557-578
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0471
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y8D9
Sequence length 580
Comment (tr|M3Y8D9|M3Y8D9_MUSPF) PHD finger protein 19 {ECO:0000313|Ensembl:ENSMPUP00000007596} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PHF19 OC=Mustelinae; Mustela.
Sequence
MENCSLDPGTRDSYGATTHLPNKGALAKAKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKI
KRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCG
LGYHQQCHIPRAGSADRPLLTPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQP
EELEWDSPHRTNQQQCYCYCGGPGEWYLRMLQCHRCRQWFHEACTQCLNEPMMFGDRFYL
FFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYFDFEEILAFVNHHWELLQLGK
LTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGKLLPDKGLGPT
ESGGASELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLA
SIFDFSLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRRTVGSRKRKLGAK
AYLPLRAKRRAAELGGRCPSDSSAEAASGPERLDEGIDSHTFESISEDDSSLSHLKSSIT
NYFGAAGRLACGEKYQVLARRVTPEGKVQYLVEWEGATPY
Download sequence
Identical sequences M3Y8D9
ENSMPUP00000007596 XP_004775681.1.14098 ENSMPUP00000007596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]