SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YBA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YBA4
Domain Number 1 Region: 8-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000159
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YBA4
Sequence length 290
Comment (tr|M3YBA4|M3YBA4_MUSPF) Family with sequence similarity 92 member B {ECO:0000313|Ensembl:ENSMPUP00000008611} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FAM92B OC=Mustelinae; Mustela.
Sequence
SGPVLPRDSQVRVMENTVTNAEKYFGQFCSLLAAYTRKTARLRDKADQLVRQLTDFANTE
NPEMRATMRNFAEDLAKVQDYRQAEVERLETKVICPLKLYGAHIKQTRAEIKKFKQVQKN
EMKQLEKLEKLRQKSPSDRQMISQAETGVQRASVDASRITHQLEEVIDTFQKQKLKDLQK
IFSDFVTIEMVFHAKAVEVYSSAFQILESYDLERDLEDFRTKMHGVYGRYDARPFKDTTP
SPAVPWALTGQSTQTTIRSQRDEEEEESTEHSAEEDPVEDLRGQGRAPQQ
Download sequence
Identical sequences M3YBA4
ENSMPUP00000008611 ENSMPUP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]