SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YDW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YDW6
Domain Number 1 Region: 426-528
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-23
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 209-318
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-18
Family PDZ domain 0.033
Further Details:      
 
Domain Number 3 Region: 698-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000077
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 4 Region: 529-601
Classification Level Classification E-value
Superfamily SH3-domain 0.000000299
Family SH3-domain 0.0039
Further Details:      
 
Weak hits

Sequence:  M3YDW6
Domain Number - Region: 2-38
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00173
Family PDZ domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YDW6
Sequence length 1112
Comment (tr|M3YDW6|M3YDW6_MUSPF) Tight junction protein 2 {ECO:0000313|Ensembl:ENSMPUP00000009523} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TJP2 OC=Mustelinae; Mustela.
Sequence
MVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQLAPPQGSPPIDEDDRAFEVMDEF
DGRSARSGYSERSRRSSHGGRSRSWEDSPERGCPHERARSRERERSRGRSLERGLDDDDY
RRARERSRGRSLERGLDHDDYGRARERSLGRGTDRAYDHYDQAYDRGYDRGYDRTYSPEA
EYGRRAQPDARYSAPRSRSREHLHSRSPSPELRGRPDHAGQSDSDRPIGVLLMKSKANEE
YGLRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQ
LVVLRDSKQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRQQYSDYDYHSSNEKLKER
PNSREDMQNRWSRMGATPTPFKAMGDTAAAVGTENSKEPRYQEEPPAPQPKAAPRTFLRP
SPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKV
NTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKE
TPQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDN
AGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGP
IADIALEKLANELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAV
DLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLYDQANKLKKTCAHLFTATI
NLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRL
ISDFEDTDGEGGAYTDNELDEPAEEPPVSSITRSSEPVQHEESIRKPSPEPRAQMRRAAS
RDQLRDSSPPPAFKPEPPKAKIQNREESFDFSRSHEYKSNPSAIAGNEVSGASTKGCPPP
VAAKPALGRSILKPSTPVPPPESEEVGEGSEEQEGTPKSVLGKVKIFEKMDHKARLQRMQ
ELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGLSQHTSSRPPEPQKGPSRLYQDPRGSYG
SDAEEEEYRQQLSEHSKRGYYGQPSRYRDTEL
Download sequence
Identical sequences M3YDW6
ENSMPUP00000009523 ENSMPUP00000009523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]