SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKQ3
Domain Number 1 Region: 57-221
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-33
Family RUN domain 0.00000059
Further Details:      
 
Domain Number 2 Region: 584-650
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  M3YKQ3
Domain Number - Region: 425-524
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YKQ3
Sequence length 654
Comment (tr|M3YKQ3|M3YKQ3_MUSPF) RUN and FYVE domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000011910} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RUFY2 OC=Mustelinae; Mustela.
Sequence
LGGGSRGLGGARGRHGNALPPFLLVPARVLGPNGRGLVLAWVPDAEGGRATKDPTAVERA
NLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTIW
GPLELVEKLYPEAEEIGASVRDLPGLNLFISNCKNWFRLTPGQRLSRDYLKNKTISISIL
NEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGN
KERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQ
EENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLR
QDVENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSE
DGLKEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDKKYLQECQSKSDNLQ
KQVSQKEKQLVQLETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIIDLKKEFLNIQD
ENQQLKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCETE
FSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQRCSSNLP
Download sequence
Identical sequences M3YKQ3
ENSMPUP00000011910 ENSMPUP00000011910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]