SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YX45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YX45
Domain Number - Region: 7-101
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family IMD domain 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YX45
Sequence length 345
Comment (tr|M3YX45|M3YX45_MUSPF) Transmembrane protein 120A {ECO:0000313|Ensembl:ENSMPUP00000015905} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TMEM120A OC=Mustelinae; Mustela.
Sequence
VQNPPPAEAPLSQCLRDWEELQQDFQSIQETHRLYRLKLEELTKLQNGCTSAITRQKKQL
QELALVLKQCKRSLQSGAREAAQELENQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNV
TLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIR
ESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQY
YYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFSLAR
DPECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQRRGSKKE
Download sequence
Identical sequences M3YX45
ENSMPUP00000015905 ENSMPUP00000015905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]