SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYZ0
Domain Number 1 Region: 59-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.53e-25
Family Ras-binding domain, RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 931-1038
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-24
Family PDZ domain 0.0000227
Further Details:      
 
Domain Number 3 Region: 244-351
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000542
Family FHA domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YYZ0
Sequence length 1050
Comment (tr|M3YYZ0|M3YYZ0_MUSPF) Rap associating with DIL domain {ECO:0000313|Ensembl:ENSMPUP00000016550} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RADIL OC=Mustelinae; Mustela.
Sequence
MFYGAHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDTTFSSLGASDDPAELSTQLS
APGVLKVFGDSVCTGTHYKSVLATCMSSAQELVKEALERYALSPECASQYVLCDVVGQAG
GSGQQWQAECFRVFGDNEKPLLIQELWKPREGLSRRFELRKKSDVEELAAKDVDTMTAGI
NAQARRLQRHRAKGTPVLAPGGARSPPTPRLRRTVSESSLSSAATQGPEERARDTMRFSL
YESPHLLLLQGYSQQHDSLVYLLNREQHTVGQRTPSSKPSVSLSAPDILPLHCTIRRHQT
PGPEPAASRLVLEPIPGAPVSVNFAEVGGRAVVLRHGDLLSLGLYYLLLFKDPAQAQPLP
AQALARLRAIPRSCGLCGAALRARGASASGSAPATLPRPRLLHLEFEPEVEDALLQRILT
LVEPGGDDHKLAPAFLLCLCIQHSATRLEPGSFGQLLLKIAKAIRETVWEKTKELAEKQA
QLQEPLSLASFPMAGLVPDLQHILFWMSNSVELLYFIQQKCPLYMQSLEEELDVTGSRES
LFSCALTASEEAMAALEEVILHAFQQCVYYVSKSLYVCLPALLECPPFQTERRESWCSAP
QLPEELRHVVSVYQATMDLLRQFRVHPEIASQVLAYLFFFSSTLLFNQLLDKGPSLSCFH
WPRGVQACARLQQLLEWMRSAGHGEAGERFFRKLSCTLNLLATPRAQLIQMSWANLRAAF
PTLSPAQLHRLLTQYQLASAVGPMSAWEPGAQDSPEAFKSEEVLESYENPPPIVLPSEGF
QVDLEADCLDDSIYQHLLYIRHFLWSLRSKPSPSGGSSQSGGLEGPHHTTSEGQSGPLVC
RGAREAGQGRPLASAGAPRAGGLSGRQSRGGPQAGPLHVDSSCLLTPPSTPLSLEPTGPD
WPEPRGTCGKVLLEGRRNAAPGGDSVGPADEPPAAPSSRSSSTEDFCYVFVVELERGPSG
LGMGLIDGLHTPLGAPGLYIQTLLPGSPAASDGRLSLGDRILEVNGSSLAGVSYLRAVNL
IRNGGKKMRFLVAKSDVETAKKIRFRTPPS
Download sequence
Identical sequences M3YYZ0
ENSMPUP00000016550 ENSMPUP00000016550 XP_012902562.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]