SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YZA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YZA1
Domain Number 1 Region: 228-306
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-30
Family PHD domain 0.0000134
Further Details:      
 
Weak hits

Sequence:  M3YZA1
Domain Number - Region: 158-211
Classification Level Classification E-value
Superfamily RING/U-box 0.006
Family RING finger domain, C3HC4 0.077
Further Details:      
 
Domain Number - Region: 74-125
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00823
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YZA1
Sequence length 384
Comment (tr|M3YZA1|M3YZA1_MUSPF) PHD finger protein 7 {ECO:0000313|Ensembl:ENSMPUP00000016661} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PHF7 OC=Mustelinae; Mustela.
Sequence
MKTIKEKKKERQRLRKSAKTRRVTQRKPSSGPVCRLCLREPGDPEKLGEFLQKDNLSVHY
FCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCVRNF
HLPCGQERGCLSQFFGEYKSFCGKHRPTQDIQRGKAGEESCVLCCEDLSQASVENIQSPC
CSQTIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDSRDAAWELEPGAF
SELYQRYQHCDAPICLYEKGRDSFEEEGRWRLILCATCGSHGTHRDCSSLRANSKKWECE
ECAPSAEATGYTPENPGDIPCCSGTFHPRRHFYRDTSREENPGPSWTDWPGPSLLEKPES
SSGRRGHPCRSKGVKITKSCKKSK
Download sequence
Identical sequences M3YZA1
ENSMPUP00000016661 ENSMPUP00000016661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]