SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZZG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZZG1
Domain Number 1 Region: 177-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.55e-57
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.12e-31
Family Tetramerization domain of potassium channels 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZZG1
Sequence length 656
Comment (tr|M3ZZG1|M3ZZG1_XIPMA) Potassium voltage-gated channel, Shal-related subfamily, member 3 {ECO:0000313|Ensembl:ENSXMAP00000007605} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MAAGVAAWLPFARAAAIGWMPVANLPMPVAPTEKNKRQDELIVLNVSGRRFQTWRNTLDR
YPDTLLGSSEKEFFYNEDTKEYFFDRDPDVFRSVLNFYRTGKLHYPRYECISSYDEELAF
FGIVPEIIGDCCYEEYKDRKRENAERLMDDQEDNKDAKLPNMTFRETMWRAFENPHTSTM
ALVFYYVTGFFIAVSVITNVVETVPCGSVPNMKEVPCGERYTVAFFCMDTACVMIFTVEY
LMRLFAAPNRYRFMRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRIFKFS
RHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSTSSKFTSIPASFWYT
IVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRA
QKKARLARIRLSKTGSSSAFLHSKRNGLFNEALELTGSTEDEKRLSKSTSLIESQHHHLL
HCLEKTTSAIYVMDSSFKKLYSTVTKNHEFVDEQYYQQSYLEAGLQNYPSQSPSLSSQDG
VTGTCCTRRSKKQHHTPLPNASAPAHMQPLKHTHTHPQGLQELSTIHIQPLIPPPPPTSR
SSLNMRVEEPAPLNCQSSQITTAIISIPTPPVTTPEGDAHLPAAPTLQNVVKVSAL
Download sequence
Identical sequences M3ZZG1
ENSXMAP00000007605 ENSXMAP00000007605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]