SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5CCU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M5CCU7
Domain Number - Region: 47-120
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.00183
Family ETX/MTX2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5CCU7
Sequence length 196
Comment (tr|M5CCU7|M5CCU7_THACB) Uncharacterized protein {ECO:0000313|EMBL:CCO37089.1} KW=Complete proteome; Reference proteome OX=1108050 OS=bottom rot fungus) (Rhizoctonia solani). GN=BN14_11240 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MKTLQVDPKHRELGVLINQNKKLVVSNSDQSALYEIAEVYLKEISWDEESTNRLTNDTRS
DLKLTVTHGVTVSTTYSTEASLNATVGAEGKGLKAEIGGEFKVITTSSREQSQSEAIEYV
LNPGETLYKYRRVYKLKIRKWWIAKYQNLERIVTEKDSYERTYAATVEDKVITDTRPSTT
KFSGVQVIDMKPVQKA
Download sequence
Identical sequences M5CCU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]