SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5EA04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5EA04
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.02e-18
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5EA04
Sequence length 107
Comment (tr|M5EA04|M5EA04_MALS4) Uncharacterized protein {ECO:0000313|EMBL:CCU99583.1} KW=Complete proteome; Reference proteome OX=1230383 OS=yeast). GN=MSY001_2289 OC=Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
Sequence
MVYVKRWSEFKARALALQAAQPERTRLVLKVQPKTQTLVVKITDDHVTLKYRAKSQIILN
RFDELQRLLLEAMSGIEAPPPAPEPASAAPPAPAPKSGGKKKKGKKK
Download sequence
Identical sequences M5EA04
XP_018740823.1.43949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]