SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M6AZD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M6AZD5
Domain Number 1 Region: 51-169
Classification Level Classification E-value
Superfamily TM1646-like 3.4e-21
Family TM1646-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M6AZD5
Sequence length 171
Comment (tr|M6AZD5|M6AZD5_9LEPT) PF03885 family protein {ECO:0000313|EMBL:EMJ66905.1} KW=Complete proteome OX=1218600 OS=Leptospira sp. P2653. GN=LEP1GSC051_1014 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKVLIPPYQLPRKETETRQTSKGKKNEISPLNGSNFSNQAETIESANSSSFLDILEEIVP
SGSETTKDLNALWRELPDIEKRFLDLPSIENLNAYQKHIQTITKSVIDQNMRVETLSKRI
KGEAKKIYHVVKIIDEKIQILAELIMNEENSAFKLLKSLTDIRGLLLDIQE
Download sequence
Identical sequences M6AZD5
WP_020781447.1.12806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]