SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M6BT24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M6BT24
Domain Number - Region: 125-188
Classification Level Classification E-value
Superfamily RAP domain-like 0.00445
Family RAP domain 0.013
Further Details:      
 
Domain Number - Region: 11-69
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0677
Family Rhodopsin-like 0.015
Further Details:      
 
Domain Number - Region: 68-101
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0759
Family Clostridium neurotoxins, "coiled-coil" domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M6BT24
Sequence length 196
Comment (tr|M6BT24|M6BT24_LEPBO) Uncharacterized protein {ECO:0000313|EMBL:EMJ82902.1} KW=Complete proteome OX=1303729 OS=Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee. GN=LEP1GSC016_2852 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MSARVFLYFSIFLILIGSAFAAYAPDLFQWETLEWIYEKRTFFLFSLIFMISIVLIYLIY
LKARRGALHSKSKTEIHLQTSLNEVVRDNQSLFSFLKSAKDTLGKQIASSRANFSPEFFS
ACSIQYQKLTQEFDLSEEIFNDIPLIPEEVGNKRKNGNNFRISEYSDLINRHRKLSRTLE
KLREDLTRLRDKVSGI
Download sequence
Identical sequences M6BT24 Q04Q81
gi|116327421|ref|YP_797141.1| 355276.LBL_0631 355277.LBJ_2502 gi|116331979|ref|YP_801697.1| WP_011669548.1.14 WP_011669548.1.30409 WP_011669548.1.38848 WP_011669548.1.421 WP_011669548.1.48790 WP_011669548.1.51921 WP_011669548.1.55252 WP_011669548.1.75262 WP_011669548.1.87468 WP_011669548.1.95176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]